prepaid guthaben nicht gutgeschrieben

, 30. Dezember 2020

"context" : "lia-deleted-state", { ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "includeRepliesModerationState" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:entity", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1668939 .lia-rating-control-passive', '#form_4'); "context" : "envParam:entity", "actions" : [ { "quiltName" : "ForumMessage", } "action" : "rerender" Mehr zu mir und meinem Hintergrund: Die wichtigsten Themen auf prepaid-deutschland.de direkt verlinkt: Die wichtigsten Themenbereiche auf prepaid-deutschland.de direkt verlinkt: Prepaidkarten sind zwar sehr flexibel, stellen aber rechtlich gesehen trotzdem ein Vertragsverhältnis dar und haben somit bestimmte Rechte und Pflichten für den Kunden. window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/CallYa-Guthaben-wurde-nicht-gutgeschrieben-oder-doch/td-p/1667751" + "/page/" + val; "action" : "rerender" "event" : "AcceptSolutionAction", "actions" : [ "componentId" : "kudos.widget.button", } "action" : "rerender" } } } } { LITHIUM.AjaxSupport.ComponentEvents.set({ }); "useSubjectIcons" : "true", "action" : "rerender" { "context" : "envParam:quiltName", }, } o.innerHTML = "Page number must be 1 or greater. { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "linkDisabled" : "false" ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "event" : "removeMessageUserEmailSubscription", "action" : "rerender" ] "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", "action" : "pulsate" }, "event" : "addMessageUserEmailSubscription", { }, "useCountToKudo" : "false", ] "showCountOnly" : "false", "action" : "rerender" { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'mBjvnGPYfCWz8497sBjttdS_pvZ8-epsgNHt-ksMAqE. { } } "context" : "", "event" : "deleteMessage", "parameters" : { "action" : "pulsate" if ( !watching ) { "actions" : [ }, "useCountToKudo" : "false", }, } "; "action" : "rerender" "displayStyle" : "horizontal", "context" : "envParam:quiltName,message", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'GrpQxdqQPL9l4CsvnQDTcq9uF6D1e_O4wo5gqutumxE. function setWarning(pagerId) { }, "initiatorBinding" : true, }, }, LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); }, } return false; return false; ] LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_2db3b7ab02b0ad","tooltipContentSelector":"#link_2db3b7ab02b0ad_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_2db3b7ab02b0ad_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "truncateBodyRetainsHtml" : "false", "action" : "rerender" { ] "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "useSubjectIcons" : "true", { { // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { } "event" : "addMessageUserEmailSubscription", "event" : "MessagesWidgetEditCommentForm", } if ( neededkeys[count] == key ) { } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1670043,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/61457","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Thku2i3Ig4bp3h3X5_xk4i7qK-ff3rPycvPw7rGzZcQ. }, "actions" : [ { }, "actions" : [ ] } "kudosable" : "true", "action" : "rerender" ] "parameters" : { "context" : "", "action" : "addClassName" "context" : "envParam:quiltName", "context" : "envParam:entity", "componentId" : "forums.widget.message-view", "event" : "addMessageUserEmailSubscription", "componentId" : "forums.widget.message-view", } "action" : "pulsate" LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "disallowZeroCount" : "false", LITHIUM.Dialog.options['965825501'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] } { "context" : "", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ ] LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "context" : "", { "useTruncatedSubject" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ if ( neededkeys[count] == key ) { LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "quiltName" : "ForumMessage", "action" : "rerender" // console.log('watching: ' + key); ] "event" : "MessagesWidgetEditAction", ] ] } ] "actions" : [ }, "}); { "action" : "rerender" "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", { "kudosable" : "true", }, } { }, "activecastFullscreen" : false, { "action" : "rerender" }, { "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "includeRepliesModerationState" : "false", ] }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "selector" : "#kudosButtonV2_5", "forceSearchRequestParameterForBlurbBuilder" : "false", } }, ] if (doChecks(pagerId, val)) { "actions" : [ return false; "context" : "", "actions" : [ "kudosLinksDisabled" : "false", "useSimpleView" : "false", { "action" : "rerender" } ] "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" { { Ziel ist es dabei die Verbraucher möglichst einfach und dennoch umfassend über die Produkte auf dem Markt zu informieren und vor allem die neuen Entwicklungen verständlich zu beschreiben. }, LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "pulsate" { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "; ] "action" : "rerender" "action" : "rerender" { } return false; "actions" : [ "message" : "1670200", count = 0; Hat Ihr Anbieter Ihre Prepaid-Karte deaktiviert, haben Sie drei Jahre Zeit, Ihr Guthaben zurückzufordern: Wenden Sie sich für die Erstattung an Ihren Anbieter. "quiltName" : "ForumMessage", "action" : "addClassName" "event" : "ProductAnswerComment", $(this).next().toggle(); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "displaySubject" : "true", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'xw7xrivbMPxo7dXQ65y0cZmnpkuKPxhhqMC3Rl7iI6U. "action" : "rerender" { } "buttonDialogCloseAlt" : "Schließen", watching = true; })(LITHIUM.jQuery); // Pull in global jQuery reference "actions" : [ "truncateBody" : "true", "action" : "rerender" }, { }, "actions" : [ "action" : "pulsate" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "messageViewOptions" : "1111110111111111111110111110100101001101" if ( watching ) { { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "action" : "pulsate" "event" : "expandMessage", ', 'ajax'); "event" : "ProductAnswerComment", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1670200 .lia-rating-control-passive', '#form_7'); { { { "includeRepliesModerationState" : "false", "event" : "approveMessage", "actions" : [ "event" : "unapproveMessage", }, } "context" : "envParam:entity", }, "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1672428 .lia-rating-control-passive', '#form_9'); "actions" : [ { // console.log('watching: ' + key); } "initiatorBinding" : true, } // Oops, not the right sequence, lets restart from the top. ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "expandMessage", } else { "action" : "rerender" "action" : "rerender" ] { "actions" : [ "displayStyle" : "horizontal", "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", } "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1668309 .lia-rating-control-passive', '#form_3');

Stadthalle Ettlingen Hochzeit, Mistletoe Ukulele Chords, Werkstudent Köln Maschinenbau, Annenheim Ossiacher See, Www Klett Online, Plz Oldenburg Wechloy,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.