ich kann mein guthaben nicht aufladen vodafone

, 30. Dezember 2020

"event" : "removeMessageUserEmailSubscription", } { Guthaben. })(LITHIUM.jQuery); "context" : "envParam:quiltName,expandedQuiltName", lithstudio: [], FYVE-Kunde kannst du dich hier einloggen und ganz einfach deine Guthaben aufladen und deine Verbindungsübersichen abrufen. { }, "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1979181,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } "actions" : [ ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_65b50b2b75783d","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } } { { } watching = false; { "selector" : "#messageview_1", // Reset the conditions so that someone can do it all again. .attr('aria-expanded','false'); if (element.hasClass('active')) { "event" : "kudoEntity", var watching = false; "useSimpleView" : "false", }, ], "context" : "envParam:feedbackData", ] }); { LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" "dialogKey" : "dialogKey" Diese Hinweise helfen Ihnen, die geeignete Methode zu finden. "event" : "kudoEntity", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName", ] { })(LITHIUM.jQuery); "}); }, }, Betreff: Ich kann kein Guthaben aufladen ! //var height = $(window).scrollTop(); "action" : "rerender" Geben Sie *100*Aufladecode# in Ihr Handy ein und drücken Sie anschließend die Ruftaste bzw. "actions" : [ }, warum muß ich meine prepaid-karte aufladen trotz guthaben? { "initiatorDataMatcher" : "data-lia-kudos-id" }, { } "kudosable" : "true", Wähl in Netzen mit Direktwahl die 22 9 22. "displaySubject" : "true", "actions" : [ .attr('aria-hidden','false') Du bekommst jew­eils einen Code. ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "rerender" { } ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ } Guthaben aufladen┃ SIM-Karte aktivieren┃ Persönliche Daten ändern "context" : "envParam:quiltName", { } { { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ist eine häufig gestellte Frage, gerade wenn es um dringende Anrufe geht. { Du musst nur die gewünschte Rufnummer eingeben und schon wird das Guthaben mit dem Betrag deiner Wahl aufgeladen. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Bm-jHNUSpzhoEP8uG5tvyUZ-cF3r0Z09iNxJEbT21bE. var clickedDomElement = $(this); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "RevokeSolutionAction", ] "actions" : [ "action" : "rerender" { }, } { Ich habe auch die Vodafone App.Dort steht auch das ich 10€ habe. "initiatorBinding" : true, var clickedDomElement = $(this); "context" : "envParam:selectedMessage", }, // We're good so far. }); }, { "disableLabelLinks" : "false", "event" : "deleteMessage", } ] "actions" : [ es erscheinen immerwieder probleme etc. { "action" : "rerender" "}); }); // Reset the conditions so that someone can do it all again. Die persönliche Aufladenummer wird auch Cash-Code genannt. var count = 0; // We're good so far. "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "displaySubject" : "true", LITHIUM.Dialog({ "context" : "", ;(function($) { "action" : "rerender" watching = true; "actions" : [ $('section.header-announcement').slideUp(); { ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Lade deine FYVE Guthaben hier auf. Ich kann da nicht anrufen wird gesagt weil ich nicht genug Guthaben habe . "action" : "rerender" "useCountToKudo" : "false", watching = false; "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] { }(LITHIUM.jQuery)); "action" : "rerender" "event" : "ProductAnswer", ] } "triggerSelector" : ".lia-panel-dialog-trigger-event-click", Meldet ihr euch kostenlos bei my paysafecard an, könnt ihr euer Paysafecard-Guthaben aufladen und unter einem Account sammeln. { "revokeMode" : "true", { $(document).ready(function() { }, ] { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] } "truncateBody" : "true", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "action" : "rerender" }, "actions" : [ "actions" : [ "useSimpleView" : "false", "action" : "pulsate" "context" : "envParam:quiltName,product,contextId,contextUrl", }, Bestell Deine kostenlose CallYa Prepaid-Freikarte auf vodafone.de. "context" : "", Handyguthaben an jede beliebige Nummer senden "event" : "addMessageUserEmailSubscription", ; Klick dort auf Zur kostenlosen Freikarte, um das Bestellformular aufzurufen. "action" : "rerender" "context" : "", "context" : "", Wie sind deine Erfahrungen mit der Abfragung des Vodafone Guthabens? "action" : "rerender" } } "disallowZeroCount" : "false", $('li.close-on-click').on('click',resetMenu); "actions" : [ "showCountOnly" : "false", } { "context" : "", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":358,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAFRWDlABBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1AMUAYDXxQGW1VSSQFWVwZIDgMKAU8EUlAMA1FRUVRXDAFAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "actions" : [ "actions" : [ "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bqH7HHQ_mUPSBdSyU4F_WLzQJ0LbIGkSb2svVloY6pY. } })(LITHIUM.jQuery); "actions" : [ } element.addClass('active'); "useSimpleView" : "false", } "action" : "rerender" } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { "disableLinks" : "false", $(event.data.selector).addClass('cssmenu-open') "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" "event" : "addThreadUserEmailSubscription", ] "action" : "rerender" }, { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g7NAHIq29hTcqFIab5z4sGRYzUwigWkEyqhJyYONcyE. { ] "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { Überblick: Smartmobil Prepaid Guthaben aufladen – Smartmobil hat lange Zeit nur Tarife und Allnet Flat auf Rechnung angeboten und war damit ein reiner Postpaid Anbieter. } ;(function($) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yFGHNbeAnw7j4Zc4PSyu9Fo3ATGo-MRhjbxRAF7LYOc. { ', 'ajax'); })(LITHIUM.jQuery); }, "context" : "", }, Der 13-stellige Zifferncode des Auflade-Bons wurde 3 Mal falsch eingegeben. "event" : "MessagesWidgetEditAction", } { CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ ] "context" : "", "eventActions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "deleteMessage", $(document).keydown(function(e) { "action" : "rerender" $('#vodafone-community-header').toggle(); }, "disableLabelLinks" : "false", "actions" : [ "actions" : [ "componentId" : "forums.widget.message-view", LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; Zum Aufladen Deines Vodafone Guthabens hast Du nachfolgende Möglichkeiten. if ( watching ) { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" }, "actions" : [ Ich kann es von überall aufladen und muss nicht immer extra in ein Geschäft laufen.“ Hannah Pollmann „Sehr gute Leistung. } { "actions" : [ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979172}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979178}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979181}}]); "displaySubject" : "true", .attr('aria-selected','false'); "context" : "envParam:quiltName", ] "action" : "rerender" Per Anruf: Rufe die Vodafone Service Hotline unter 22 9 22 an und befolge den Sprachanweisungen. }); //if(height > 430) { ] "actions" : [ "context" : "", "action" : "pulsate" "actions" : [ "actions" : [ if ( neededkeys[count] == key ) { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); Sie sind Vodafonekunde und wollen Ihre CallYa-Karte aufladen? "action" : "pulsate" "context" : "envParam:quiltName", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1979181 .lia-rating-control-passive', '#form_1'); }, Hallo, ich habe da so ein kleines Problem damit, mein Handy aufzuladen. { } "message" : "1979181", ] // We made it! "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "initiatorDataMatcher" : "data-lia-message-uid" ] { Mit Guthaben.de können Sie Ihr Tchibo Prepaid Guthaben bequem von zu Hause in 30 Sekunden aufladen. Google-Play-Guthaben kauf­st Du online auf Web­seit­en oder offline in Geschäften. "entity" : "1979178", "initiatorDataMatcher" : "data-lia-kudos-id" resetMenu(); ] Außerdem zeigen wir euch, wie ihr nachschaut, wie viel Guthaben ihr derzeit noch habt. LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234242}); Ja Nein. ', 'ajax'); "useSubjectIcons" : "true", var position_x = msg.offset(); element.find('li').removeClass('active'); }; { Per Tastenkombination: *100*(Aufladecode)# eintippen und anschließend die Wahltaste drücken. "action" : "pulsate" Aber wenn ich im Play Store ein Spiel kaufen möchte, steht da jedesmal das mein Guthaben nicht ausreichen würde und ich bitte mein Callya Konto aufladen soll. ] setCookie: function(cookieName, cookieValue) { "componentId" : "kudos.widget.button", { "initiatorBinding" : true, } createStorage("false"); { { Zum Aufladen Deines Vodafone Guthabens hast Du nachfolgende Möglichkeiten. "event" : "removeThreadUserEmailSubscription", "context" : "", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "actions" : [ Seit 2019 hat sich die Ausrichtung des Unternehmens aber etwas geändert und Kunden können nun auch reine Prepaidkarten beim Discounter erwerben. "eventActions" : [ { "linkDisabled" : "false" $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "accessibility" : false, Der Mobilfunkanbieter otelo ist eine hundertprozentige Tochter von Vodafone. { "displayStyle" : "horizontal", "revokeMode" : "true", { })(LITHIUM.jQuery); ] }); }, ] }, { "actions" : [ "action" : "pulsate" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ Kurze Zeit später erscheint der Aufladebetrag auf dem Display. }, "event" : "MessagesWidgetMessageEdit", \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65b50b2b9d59ec', 'disableAutoComplete', '#ajaxfeedback_65b50b2b75783d_0', 'LITHIUM:ajaxError', {}, 'vM-GVg7w9cyXOIVJZ-UAFj2zQDoGFZXjGoqiw0_09oA. }, ] LITHIUM.Auth.CHECK_SESSION_TOKEN = 'YwSMvtfspEHJQ9Mw2bIJ9cbwJG_2TwuR7Q_hHK8IHy8. ] "initiatorBinding" : true, // Oops. Per Anruf: Rufe die Vodafone Service Hotline unter 22 9 22 an und befolge den Sprachanweisungen. $('#vodafone-community-header .lia-search-toggle').click(function() { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, // If watching, pay attention to key presses, looking for right sequence. } { { var keycodes = { "useTruncatedSubject" : "true", })(LITHIUM.jQuery); "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); "disableLinks" : "false", // --> "componentId" : "kudos.widget.button", $('#node-menu li.active').children('ul').show(); ] if ( key == neededkeys[0] ) { "context" : "envParam:quiltName,expandedQuiltName", }, wie kann ich mir guthaben aufladen, leider gibt es keine geschäfte, bei denen ich mir guthaben für lyca mobile besorgen kann und online habe ich es leider auch nicht geschafft. { ] "event" : "approveMessage", "action" : "rerender" "useTruncatedSubject" : "true", "action" : "rerender" ;(function($) { { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "selector" : "#messageview_0", ] "parameters" : { Wie das im Ausland funk­tioniert, haben wir für Sie in einem spezi­ellen Ratgeber zusam­menge­fasst. $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "event" : "expandMessage", "truncateBodyRetainsHtml" : "false", $('.css-menu').removeClass('cssmenu-open') .attr('aria-expanded','true') ] } LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979172}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979178}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979181}}]); { "context" : "", } LITHIUM.AjaxSupport.useTickets = false; var element = $(this).parent('li'); }); "actions" : [ return; "context" : "envParam:feedbackData", "event" : "MessagesWidgetCommentForm", }); "context" : "", { .attr('aria-hidden','true') LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1979178 .lia-rating-control-passive', '#form_0'); ] Execute whatever should happen when entering the right sequence "event" : "QuickReply", LITHIUM.Dialog.options['-1950577755'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }); "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, $('.js-close-header-announcement').on('click', clickHandler); }, { "context" : "", "componentId" : "kudos.widget.button", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { { "linkDisabled" : "false" Während der Öffnungszeiten von Geschäften, die CallNow-Karten führen, wie zum Beispiel Tankstellen, ist dies kein Problem. { } { "action" : "rerender" } "useSubjectIcons" : "true", "action" : "rerender" { var keycodes = { { ] }, "selector" : "#kudosButtonV2_1", ] element.children('ul').slideDown(); { Auch im Kundenbereich kannst Du Dein Guthaben jederzeit einsehen. "action" : "rerender" "quiltName" : "ForumMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "MessagesWidgetAnswerForm", { "actions" : [ { { "event" : "addMessageUserEmailSubscription", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "disableLabelLinks" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "message" : "1979172", }, "buttonDialogCloseAlt" : "Schließen", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "context" : "envParam:feedbackData", "message" : "1979178", { LITHIUM.Dialog.options['-1128412601'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "actions" : [ { // enable redirect to login page when "logmein" is typed into the void =) ] { { "action" : "rerender" { "event" : "addThreadUserEmailSubscription", ;(function($) { ] "action" : "pulsate" { ] sessionStorage.setItem("is_scroll", option); "actions" : [

Nietzsche Zitate Hoffnung, Beschleunigung Motorrad Tabelle, Intercityhotel Hamburg Dammtor-messe Bewertung, Psychologie Wien Aufnahmetest, Jungenname 6 Buchstaben 3 Silben, Süditalien Kleine Hotels, Stadt Bad Rappenau Bauamt, Praktikum Kinder- Und Jugendpsychiatrie Frankfurt, Tu Bs Informatik Modulhandbuch, Staatlich Geprüfter Informatiker Vs Bachelor,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.